PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 684aa    MW: 77183.8 Da    PI: 6.2568
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003871.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.51.4e-1113106802373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   +lL++cA+av+s d++ a++ L+++++ +sp+gd+ qRla+yf+ +L+arla+ ++  y+ l  +++s    +e l+a+++ +  sP+   sh++aN
  Pbr003871.1 310 STLLTQCAQAVASYDQQTARERLQKIRHYSSPRGDAKQRLAHYFADGLEARLAGATTPSYSFLVGTQSS---AAEILKAFQVSVSSSPFKHTSHFVAN 404
                  579***************************************************99999*999999998...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                  ++I++  e+++r+Hi+Df+i +G+QWp+++q L++Rp+gpp+lRiT+++ p++g   +e++eet++rL+k+Ae+++vpfe nv +a+++e++++e+L+
  Pbr003871.1 405 RTIMKLSENATRLHIVDFGIDYGFQWPCFIQHLSERPGGPPKLRITAIELPQPGfrPTERVEETARRLKKYAERFNVPFECNV-IAQKWETIKFEDLK 501
                  *****************************************************9****************************9.7************* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++++E ++Vn++++l++++de+  l+s  +rd vLkl+++++P+v+++   +  ++++ F++rf eal +ysalfd +ea++pre+e r   E+++ g
  Pbr003871.1 502 IDRNEPTVVNCMFRLKNIPDETEMLSSasPRDIVLKLIRKINPDVFIHGIVNGTYTAPFFAARFREALFHYSALFDIFEATVPREDEMRLLFEKAVYG 599
                  ********************9988877779******************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  r+ivnv+aceg er+er et+++W+ r  +aGFk++pl+++  kq++++ + ++ d + ++e+ +++++gWk++ L+++S W
  Pbr003871.1 600 RDIVNVIACEGLERVERPETYKQWQFRNVRAGFKQLPLDQELLKQVRRMSKCYH-DDFWIDEDGNWMLQGWKGKILLAISIW 680
                  ************************************************998888.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.955283662IPR005202Transcription factor GRAS
PfamPF035145.0E-109310680IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MDTLLERCDV SMERFNFGVH PHQNLVNGFK MDHESTYSIF LPTNVDHNSS DSSPPLNTGS  60
DGDSTDPGDF NHPVLKHISD ILLEEDLEGK PCMLQDCLAL QAAEKSFFDV LNPRGPPSPN  120
QPPLSHSLEN PDDDSTPSSH SCNGTSIPSE TSHFQSYLAE SQSDNVLVSD PLSEMQSFGH  180
FGGVGEACKF LPNESFGTID LERCHLMSPG PGPCPPGIRT LMRRPENDGH NSTNILKGKK  240
HHQREDGDYP EEGRSSKQPV AFADDSEPQE MFDEVLLSHG RHHFGNKQSK GSKTTRSKKQ  300
NSNAEIVDLS TLLTQCAQAV ASYDQQTARE RLQKIRHYSS PRGDAKQRLA HYFADGLEAR  360
LAGATTPSYS FLVGTQSSAA EILKAFQVSV SSSPFKHTSH FVANRTIMKL SENATRLHIV  420
DFGIDYGFQW PCFIQHLSER PGGPPKLRIT AIELPQPGFR PTERVEETAR RLKKYAERFN  480
VPFECNVIAQ KWETIKFEDL KIDRNEPTVV NCMFRLKNIP DETEMLSSAS PRDIVLKLIR  540
KINPDVFIHG IVNGTYTAPF FAARFREALF HYSALFDIFE ATVPREDEMR LLFEKAVYGR  600
DIVNVIACEG LERVERPETY KQWQFRNVRA GFKQLPLDQE LLKQVRRMSK CYHDDFWIDE  660
DGNWMLQGWK GKILLAISIW VPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-403136808374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364374.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5W7W50.0M5W7W5_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-175SCARECROW-like 14